PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA9659
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family G2-like
Protein Properties Length: 429aa    MW: 47264.5 Da    PI: 6.9997
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA9659genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.2e-28155209156
                   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                               k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQkYR++
  Tp57577_TGAC_v2_mRNA9659 155 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILELMGIDCLTRHNIASHLQKYRSH 209
                               5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.152152211IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-26153212IPR009057Homeodomain-like
SuperFamilySSF466893.23E-18153212IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-26155209IPR006447Myb domain, plants
PfamPF002494.6E-8158207IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
LSVDLGLLML AVSPLRSTKD ENQGEMESFS ITTDEFGDLS DENLLENINF DDFFVGINLD  60
GDILPDLDMD SEMFTEFSAS YGEESDINSS AMNKTDEKSY SKNKDKTIYS GRQGSEKTVS  120
KRDEYVVVNP PLQKDGGGKG RKSSSQSKNT QGKRKVKVDW TPELHRRFVQ AVEQLGVDKA  180
VPSRILELMG IDCLTRHNIA SHLQKYRSHR KHLLAREAEA ASWNQRRQVY GGVGGKREVM  240
SPWPAAAAAP IMGFPPTPPI PMTPLHHFRP LHVWGHPSID QSFMHMWPKP HLPHSAPPQP  300
LSWPTAAAPP PPQDPSSWHS HHQLTPNAII RGTHYFSQPL TTVRSFGCQI PGGIPQHAMH  360
KHKADHAIAA PGPGLAPFDF YPSKESLDAA IGDVLSKPWL PLPLGLKAPA LDSVMGELHK  420
QGVSDIPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-16152207257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0955032e-85BT095503.1 Soybean clone JCVI-FLGm-19O16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607509.21e-173transcription activator GLK1-like protein
SwissprotQ9SIV31e-87GLK1_ARATH; Transcription activator GLK1
TrEMBLG7JTX71e-173G7JTX7_MEDTR; Transcription activator GLK1-like protein
STRINGGLYMA12G33430.11e-158(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.18e-80GBF's pro-rich region-interacting factor 1